Protein Info for ABI39_RS05420 in Phocaeicola dorei CL03T12C01

Annotation: D-tyrosyl-tRNA(Tyr) deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR00256: D-tyrosyl-tRNA(Tyr) deacylase" amino acids 1 to 146 (146 residues), 186.8 bits, see alignment E=1.5e-59 PF02580: Tyr_Deacylase" amino acids 2 to 145 (144 residues), 198.4 bits, see alignment E=3.5e-63

Best Hits

Swiss-Prot: 97% identical to DTD_BACV8: D-aminoacyl-tRNA deacylase (dtd) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K07560, D-tyrosyl-tRNA(Tyr) deacylase [EC: 3.1.-.-] (inferred from 97% identity to bvu:BVU_1211)

Predicted SEED Role

"D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)" (EC 3.6.1.n1)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.- or 3.6.1.n1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>ABI39_RS05420 D-tyrosyl-tRNA(Tyr) deacylase (Phocaeicola dorei CL03T12C01)
MRVVIQRVSHASVTIEGVCKSAIKEGFMILVGIEEADTQEDADWLCKKIIGLRVFDDENG
VMNKSIREVEGNILVISQFTLHASTKKGNRPSYIRAAKHDIAIPLYDYFCRELSIGLGKE
VGTGEFGADMKVELLNNGPVTICMDTKNKE