Protein Info for ABI39_RS05300 in Phocaeicola dorei CL03T12C01

Annotation: calcium/sodium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 3 to 312 (310 residues), 231.8 bits, see alignment E=5.2e-73 PF01699: Na_Ca_ex" amino acids 4 to 150 (147 residues), 110.3 bits, see alignment E=4.4e-36 amino acids 175 to 317 (143 residues), 126.2 bits, see alignment E=5.4e-41

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to bvu:BVU_1233)

Predicted SEED Role

"Sodium-calcium exchanger"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ABI39_RS05300 calcium/sodium antiporter (Phocaeicola dorei CL03T12C01)
MLNTLLLIGGLALILAGANGLTDGSAAVAKRFRISDLVIGLTIVAFGTSAPELVISVLSA
LNGSAEMAIGNVVGSNIFNALMIIGCTALVLPIKVGEGTMSKEIPLVILSSLVLFVCAND
MMLDREAVNVISRSDGFVLLAFFLIFMRYTFAIARNGADEAGEEQKIKEMPVWKSVLYIA
GGLAGLIFGGQLFVDGASGLARSWGVSESVIGLTLVAGGTSLPELATSVTAALKKNPGIA
IGNVIGSNLFNIFFVLGCSATVSPLPMGNINNLDLSVLIASSLLLWLVGWFFRKRTITRL
EGALMVGCYVVYTAYLIAQQ