Protein Info for ABI39_RS02935 in Phocaeicola dorei CL03T12C01

Annotation: SusD/RagB family nutrient-binding outer membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12741: SusD-like" amino acids 75 to 298 (224 residues), 92.2 bits, see alignment E=4e-30 amino acids 432 to 648 (217 residues), 99.4 bits, see alignment E=2.6e-32 PF12771: SusD-like_2" amino acids 80 to 299 (220 residues), 78.6 bits, see alignment E=4.9e-26 amino acids 394 to 589 (196 residues), 50.9 bits, see alignment E=1.2e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>ABI39_RS02935 SusD/RagB family nutrient-binding outer membrane lipoprotein (Phocaeicola dorei CL03T12C01)
MKKVNKLLFSLVMGAALMGGATSCDDFEEINFSPSAAGESYIHPDYALNKSFYEAQMDPD
IAERVFVYNWASITRIIGDNTMGVTARYSNEYNDRLYSYTSNWVKYATNAINMADVNPGT
SEHEQAFFPNVKQFARIWRVMLIADFADSFGPYALDAAQGVNPTFNSVEDVYVFMLTELK
EAAAGINTSVEPTETEAKGDPAFGYNAAKWVKLAHSLRLRYAMRLSEVSTSKIDVKAEFA
DAASKSLLTSADDFFSFPEAGGWSCYEGVMNRPWNDQCISSTMCNLLTGLGDIPVTSYRP
DLAPYIKPMNYIGEQYVNHYPVTTDNPTKQLWMDGIPEHLDPRALKVWCLTNDEKAENFP
DQGSQGVKNHAEHAMLDPTDPEKKLVKIDAQFTWNGYPAGTRSAWSTETFKFNDVLGSMY
DTTPMLGKQYRDNTARRIWMSPWETYFLLAEGALRGWTNSISAKEAYENGVRANFEYLGL
SQYVNQYLASTSYNRVGTSVNFDHTVEPVSFEADYVNGYTKQAGKMTYNYPDASKILYKG
GALNDQLTKIITQKYIANVPYGVVEMWNDRRRLGLPFFEIPANEGTLTGSDMEKYIQASE
WKNGQKWYHYTQRMRYPTALENADKEQYQNALQLLGAEDNTMMTPLWWAIK