Protein Info for ABI39_RS02300 in Phocaeicola dorei CL03T12C01

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13616: Rotamase_3" amino acids 172 to 274 (103 residues), 73.5 bits, see alignment E=3.3e-24 amino acids 275 to 373 (99 residues), 27.6 bits, see alignment E=5.5e-10 PF00639: Rotamase" amino acids 185 to 271 (87 residues), 73.1 bits, see alignment E=4.8e-24 amino acids 282 to 379 (98 residues), 43.3 bits, see alignment E=9.3e-15

Best Hits

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 99% identity to bvu:BVU_0425)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ABI39_RS02300 peptidylprolyl isomerase (Phocaeicola dorei CL03T12C01)
MCTKVYALVLMLFAAVSVYGQDNVIDEVVWVVGDEAILKSDVENERLNAQYEGRKFDGDP
YCIIPEQLAIQKLFLHQAAIDSIEVSEQEIISDVERRTNWLIDQIGSKEKVEEYYNKTST
QIREMLRENIRDGKTVQKMQQQIVGDIKITPAEVRRYFKDLPQDSIPFIPTQVEVQIITM
EPKIPQEEIERVKKTLRDYTERVTSGEIAFSTLARLYSEDEGSRRRGGELGFMGRAELVP
EYANVAFNLQDPNKVSKIVESEFGFHIIQLIEKRGDRINTRHILLKPKVDEKDLEAALLR
LDSIANDIRNEKFTFDDAATYISHDKDTRNNHGLMANPQTGTARFEMQQLAQVSQEAAKM
VEGMNVGEISKPFTMINAKGKEICAIVKLKTRLNGHKATITEDYQRLKGIVMEKRSEEKL
DKWIKDKQKHTYVRINEKWQKCDFKYPGWVKK