Protein Info for ABI39_RS01740 in Phocaeicola dorei CL03T12C01

Annotation: histidine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02329: HDC" amino acids 103 to 197 (95 residues), 43.1 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to bvu:BVU_0329)

Predicted SEED Role

"Histidine decarboxylase proenzyme (EC 4.1.1.22)" (EC 4.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>ABI39_RS01740 histidine decarboxylase (Phocaeicola dorei CL03T12C01)
MKELELTSNAALTDAVYETALNGSFLEVKLVAGSVGDDEPRGMQPEYECYHISYPDKKDT
ILFEQPLDAADDKVTVYDLGKKIKSIEGCCHKTLTKGESRTATARKVVAHGPMWIYVAIA
IGMDKAGTESPFMIVQGAGTYGSENTTESEMIGYVDGRIHEMTALLVRRAHLKTLHLASI
RVGYKYLFVEPGRIGKAKVKEG