Protein Info for A4249_RS15550 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 26 (3 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details PF05227: CHASE3" amino acids 44 to 167 (124 residues), 36.2 bits, see alignment E=8.3e-13 PF00672: HAMP" amino acids 202 to 251 (50 residues), 29.2 bits, see alignment 1.4e-10 PF00015: MCPsignal" amino acids 396 to 553 (158 residues), 181.3 bits, see alignment E=2.3e-57

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 55% identity to cse:Cseg_0224)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NZF5 at UniProt or InterPro

Protein Sequence (643 amino acids)

>A4249_RS15550 methyl-accepting chemotaxis protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSVGRKLFAAFGLVLAAIAVMGVVVVTSLLQLEKAGEVRTVENQANRTTATAEFYMTRQE
NAFRGYLLSQDPYYIERVDAHRAKFRAAMDELRGELPADRAALIDKAVEANATWYKNVVE
AGSAMVRDGRASQAVQMVGRNGTADNYVAPVEDTIDQIKSANELARKASTEAQAAASRTA
LIATIVGLISALVIAVIAGFVATRSIVRPIFTMIGYMQKLMAGDTDIKVASAERKDEFGK
MGQAIVAFRDAAIEKVRVEQEAIANRSMSEQERAEREAEKAREAAEDAQAIGALGQGLSA
MSNGDLTYRIEIDFNPKTAQLKADFNAAISQLQQAVSVVVNNVSGIRSGAGEISQAADDL
SRRTEQQAASLEETAAALDEITATVNKTASGARQASDVVQAARGDAEKSGIIVRDAVQAM
TAIEGSSTQINQIIGVIDEIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQRSA
EAAKEIKTLISASTGQVGSGVKLVGETGEALQRIVDRVAEIDSLVTEIAASAQEQAVGLA
QVNTAVNQMDQVTQQNAAMVEQSTAASHSLAQEAESLQASVAQFRVGASSPRAAAPTPVR
TPVPVAKPAPRSSHMVAALKTIGRGGAAPRPQVTAAEDGWEEF