Protein Info for A4249_RS15510 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: CarD family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF02559: CarD_TRCF_RID" amino acids 9 to 59 (51 residues), 54.1 bits, see alignment E=1.3e-18 PF21095: CarD_C" amino acids 75 to 160 (86 residues), 89.3 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 36% identical to CARD_MYCTU: RNA polymerase-binding transcription factor CarD (carD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07736, CarD family transcriptional regulator (inferred from 89% identity to bsb:Bresu_3015)

Predicted SEED Role

"CarD-like transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1P7 at UniProt or InterPro

Protein Sequence (176 amino acids)

>A4249_RS15510 CarD family transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MTSKTGLEFKVGDAVVYPAHGVGKVAAIETQEVAGMSLEVYVVTFDHEKMTLRVPTKKAV
TAGLRSLAADDVVTKALTTLKGRARIKRTMWSRRAQEYEAKINSGDLISIAEVVRDLHRA
DTQPEQSYSERQLYESALDRMAREVAAANKIDKDAAVELLAKSLSAKKPIPTAEAA