Protein Info for A4249_RS15400 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF00438: S-AdoMet_synt_N" amino acids 7 to 117 (111 residues), 113.3 bits, see alignment E=1e-36 TIGR01034: methionine adenosyltransferase" amino acids 8 to 400 (393 residues), 462.8 bits, see alignment E=4.1e-143 PF02772: S-AdoMet_synt_M" amino acids 131 to 245 (115 residues), 135.5 bits, see alignment E=1.6e-43 PF02773: S-AdoMet_synt_C" amino acids 247 to 390 (144 residues), 200.5 bits, see alignment E=1.6e-63

Best Hits

Swiss-Prot: 66% identical to METK_RUEPO: S-adenosylmethionine synthase (metK) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 75% identity to ccr:CC_0050)

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I219 at UniProt or InterPro

Protein Sequence (401 amino acids)

>A4249_RS15400 methionine adenosyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MAARSSFLFTSESVSEGHPDKVADRISDTVVDAFLAKDPEARVACETLVTTQRIVLAGEV
RATQPGNTKEQNEAFTQSIIDSLEPLVRAAVKDIGYEQDGFHWETADYSCFLHAQSADIA
VGVDSTNEKDEGAGDQGIMFGYASNETPELMPATLQYSHNILKRLAEVRHAGGSQLEPDA
KSQVTIEYEDGKPVRATSIVLSTQHAKGLSSEQVAEIVKPYILEVLPEGFTDENTVWHIN
PTGIFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYACRYLAKNV
VAAGLADRCTIQISYAIGVAKPQSIHVDLHGTGKISEAVLEDKILDLIGGATPRAIRQHL
QLNKPIYARSAAYGHFGREPDADGGFSWEKTDLVDQLKALA