Protein Info for A4249_RS15080 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA polymerase III subunit gamma/tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 65 to 424 (360 residues), 401.1 bits, see alignment E=2.4e-124 PF13177: DNA_pol3_delta2" amino acids 82 to 244 (163 residues), 114.3 bits, see alignment E=2.2e-36 PF13604: AAA_30" amino acids 101 to 211 (111 residues), 29.2 bits, see alignment E=3.1e-10 PF13401: AAA_22" amino acids 103 to 218 (116 residues), 30.4 bits, see alignment E=1.8e-10 PF07728: AAA_5" amino acids 103 to 211 (109 residues), 25.5 bits, see alignment E=4.8e-09 PF00004: AAA" amino acids 104 to 238 (135 residues), 39.7 bits, see alignment E=2.6e-13 PF22608: DNAX_ATPase_lid" amino acids 250 to 294 (45 residues), 56.3 bits, see alignment 8.8e-19 PF12169: DNA_pol3_gamma3" amino acids 300 to 440 (141 residues), 146 bits, see alignment E=2.8e-46 PF12362: DUF3646" amino acids 480 to 593 (114 residues), 119 bits, see alignment E=5.3e-38

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 82% identity to bsb:Bresu_0592)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NT55 at UniProt or InterPro

Protein Sequence (615 amino acids)

>A4249_RS15080 DNA polymerase III subunit gamma/tau (Brevundimonas sp. GW460-12-10-14-LB2)
MTDSDTNLDGPPWEEDDVAPRDENTDDMFGAPAAAPEPVVAPAAAPVAKPAPAEVAAHVD
DGAAYQVLARKYRPRTFEDLIGQEAMVRTLTNAFATGRIAHAFMLTGVRGVGKTTTARLL
ARALNNETDVIDKPSLTLTAHGRHDAAIMAGQHMDVMEMDAASHTGVNDIRDILESVRYA
PVEARYKVYVLDEVHMLSTQAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFD
LRRVEPEILVEHLGRIADREGMKIENDALALISRAAEGSVRDGLSLLDQALVQAERGETV
KTETVRDMLGLADRTQTIALFESVMAGRTPEALESFRTLYGFGADPVQVTNDLLEHCHAA
SVAKMLGPNATRLPNDQAQKLAALGAAIPAATLSRTWQMLLKALDEVRRAPNPADAVEMA
IVRLAYAADLPGPEEALKRLQSGEPMGGGSAPRGGGGGSGGGTSAQLAARPVMAPALPDP
QTFEQVVALIGEKREVGLQMDVERYVKPVSFKPGAIVYESVQGAPIELARKLSARLREWT
GRTWLIAANGQGGAETVIEIQKKARAAERAEVEANPFVQAVLQAFPGAKLGEIKTIAPTV
VTPEIPDVVEDDDED