Protein Info for A4249_RS14920 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 50 to 68 (19 residues), see Phobius details PF00583: Acetyltransf_1" amino acids 19 to 135 (117 residues), 57.5 bits, see alignment E=2.4e-19 PF13673: Acetyltransf_10" amino acids 41 to 142 (102 residues), 44.9 bits, see alignment E=1.7e-15 PF13508: Acetyltransf_7" amino acids 48 to 136 (89 residues), 47.4 bits, see alignment E=3.1e-16

Best Hits

Swiss-Prot: 46% identical to YHFO_BACSU: Uncharacterized N-acetyltransferase YhfO (yhfO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 48% identity to nde:NIDE1068)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I074 at UniProt or InterPro

Protein Sequence (148 amino acids)

>A4249_RS14920 GNAT family N-acetyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MAIIVQKAGVEHIDALVPLFDAYRQFYRRPSAPDDARAFLLERIEREQSVVFLAFEGTAA
VGFVQMFPSFSSAAMRSILILNDLFVAPSARGTGAGRALLDMAASHGRQVGAARLTLSTE
NTNTSARAIYEHMGWVPSTDFQHYNLAL