Protein Info for A4249_RS14840 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: carboxynorspermidine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF00278: Orn_DAP_Arg_deC" amino acids 150 to 344 (195 residues), 31.7 bits, see alignment E=7.3e-12

Best Hits

KEGG orthology group: K13747, carboxynorspermidine decarboxylase [EC: 4.1.1.-] (inferred from 78% identity to cak:Caul_4441)

Predicted SEED Role

"Carboxynorspermidine decarboxylase, putative (EC 4.1.1.-)" in subsystem Polyamine Metabolism (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NSH2 at UniProt or InterPro

Protein Sequence (390 amino acids)

>A4249_RS14840 carboxynorspermidine decarboxylase (Brevundimonas sp. GW460-12-10-14-LB2)
MQTQAGDPGAFAHFDLNRVASPAFVVDEAAIRRNLSVLKGVRDGAEARVLLALKAFSMWS
LADVVGEYLDGVCASGLWEARLAREFYKGELTTYSPAYTAQDLPEILRLSDHVIFNNPAQ
IARFADLIAKARADGQVFEIGLRLNPEHSEGEVAKYDPAQPCSRLGFPVSQLTADHLVGV
DGLHIHALCEQDFQPLSRIWAAVEPKLAPLLGGIKWLNLGGGHHITRADYQTDDLIAFVR
DLQARHGVQVYLEPGEAVALDAGILIGEVLDVFDNGMPIGITDISATCHMPDVIEAPYRP
ALLKESEHGVTVRLGGPSCLAGDIIGDYVFAERPTPGTRIAFLDQAHYSMVKTNTFNGVP
LPSIVLWNSQTDALRTVRAFDYSAFRDRLS