Protein Info for A4249_RS14670 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MarC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 5 to 211 (207 residues), 147.1 bits, see alignment E=2.7e-47 PF01914: MarC" amino acids 8 to 214 (207 residues), 142.6 bits, see alignment E=5.6e-46

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 79% identity to bsb:Bresu_0508)

Predicted SEED Role

"Membrane protein, MarC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NS46 at UniProt or InterPro

Protein Sequence (231 amino acids)

>A4249_RS14670 MarC family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MNAVDLGVNLFVTLFALLDPIGNLPIFAAATAGATLRQRISVSALICAFAAVFLAFFLFT
GLGLLQFFGISLAAFRIAGGILLLFLGLDMARGDFLAMFADKDALADSKDVRGYARRRFQ
RLVVPFAIPLMIGPGAISAVIIQAGEAAKLGYAGTMGSLVAIAAACAVSFVCFALTGSLS
RLLGEVGMAIIVKVLGLILCALAIQFILLGLGEAIPGMISGAVTTPYPAAK