Protein Info for A4249_RS14570 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: complex I NDUFA9 subunit family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF08659: KR" amino acids 7 to 121 (115 residues), 26.2 bits, see alignment E=2.5e-09 PF00106: adh_short" amino acids 8 to 124 (117 residues), 27.3 bits, see alignment E=8.2e-10 PF05368: NmrA" amino acids 9 to 239 (231 residues), 51 bits, see alignment E=4.8e-17 PF01370: Epimerase" amino acids 10 to 219 (210 residues), 84.1 bits, see alignment E=3.7e-27 PF04321: RmlD_sub_bind" amino acids 10 to 222 (213 residues), 47.1 bits, see alignment E=6.1e-16 PF01073: 3Beta_HSD" amino acids 12 to 125 (114 residues), 40.7 bits, see alignment E=5.4e-14 amino acids 130 to 202 (73 residues), 22 bits, see alignment E=2.6e-08 PF13460: NAD_binding_10" amino acids 13 to 157 (145 residues), 75.3 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: None (inferred from 65% identity to bsb:Bresu_0769)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1V5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>A4249_RS14570 complex I NDUFA9 subunit family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MADLAPGVVTLFGGSGFIGSQAVRALARRGWRIRVAVRNPVLAIEIQPLGDPGQIQFMRC
DITNPADVAQAVRGADAVVNLVGVLHDAGGKRGFDAVHTEAAKTIAEAAKAAGVERLVQI
SAIGADAASPSAYGRTKAQAEAAVRDVYPDAVILRPSLVFGAGDGFLNRFAAMATMAPAL
PLIGGGETRFQPVYVGDVAEAIARGVTRADAAGRTYELGGPSLYTFREVLELVRRETGRD
RMLVSVPFIVAKPLGSLLQLSRFVGLTPPLTHDQVLMLEKDNVVAADALGLSDLGIDHPA
GMAAIAPSYLWRYRVGGQFAEAPAH