Protein Info for A4249_RS14210 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ribonucleotide-diphosphate reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 101 to 120 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details PF00268: Ribonuc_red_sm" amino acids 22 to 292 (271 residues), 252.1 bits, see alignment E=3.6e-79

Best Hits

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 87% identity to bsb:Bresu_0121)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1A6 at UniProt or InterPro

Protein Sequence (349 amino acids)

>A4249_RS14210 ribonucleotide-diphosphate reductase subunit beta (Brevundimonas sp. GW460-12-10-14-LB2)
MNAITPIILPERAGLLTPSAAYKPFRYPWAFDMWKKQQQVHWMPEEVPLGEDVKDWASTL
NDGERNLLTQIFRFFTQADIEVQDNYMERYGRVFKPTEVKMMLAAFGNMETIHIAAYALL
LETIGMPESEFGAFMEYEAMRDKHDYMGKFGVDSDADICRTLAMFGGFSEGVQLFASFAM
LMNFPRQNKMKGMGQIVSWSVRDESLHCEGIIKLYHAFNKETGAVTKSVADDIVDCCKTV
VNMEDKFIDLAFEMGSVQGMTPDDIKQYIRFIADWRLRQLKLPEVYGVTENPLPWLQSLL
SGVEHANFFEARATEYSKAATQGNWHGADGVWTEFDRMMARRDMSLVAG