Protein Info for A4249_RS13525 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 949 PF07517: SecA_DEAD" amino acids 6 to 391 (386 residues), 434.5 bits, see alignment E=5.6e-134 TIGR00963: preprotein translocase, SecA subunit" amino acids 27 to 463 (437 residues), 662.5 bits, see alignment E=4.6e-203 PF00270: DEAD" amino acids 98 to 214 (117 residues), 29.1 bits, see alignment E=2.5e-10 PF01043: SecA_PP_bind" amino acids 231 to 348 (118 residues), 124.8 bits, see alignment E=7.1e-40 PF21090: P-loop_SecA" amino acids 407 to 655 (249 residues), 283 bits, see alignment E=4.1e-88 PF07516: SecA_SW" amino acids 657 to 869 (213 residues), 227.4 bits, see alignment E=5.4e-71 PF02810: SEC-C" amino acids 929 to 946 (18 residues), 37.4 bits, see alignment (E = 5.3e-13)

Best Hits

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 86% identity to bsb:Bresu_0024)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZM0 at UniProt or InterPro

Protein Sequence (949 amino acids)

>A4249_RS13525 preprotein translocase subunit SecA (Brevundimonas sp. GW460-12-10-14-LB2)
MLGFAKKLFGSSNDRKVKAFQDHAQRINALEPKFAALSDDELRMMTDAFRDRLANGETLD
KILPEAFAVVREASKRVLGQRQYDVQLAGGMILHEGGIAEMRTGEGKTLVAVAPVYLNAL
PGKGVHVITVNDYLARRDAETMGKVYRFLGLEVGVIVNGLSQGQRQQAYNADVTYGTNNE
FGFDYLRDNLVYDRREMVQRPHNFAIVDEVDSILIDEARTPLIISGPTEDRSDLYKILDG
LIKDLIKDKDTFELDEKQKQVLLTELGSERMEEALEAGGHFAADTTGLYDAANISLVHHA
NQALRANTLYQRDKDYIIKGGEIVLIDEFTGRMMTGRRLSEGLHQAIEAKEDVKIQPENQ
TLASVTIQNYFRLYEKLSGMTGTAATEAQEFGDIYKMDVLEVPTNRPIQRKDYDDEVYRT
HAEKNQAIARQIAECHLAGQPILVGTVSIERSEQLSDLLSRFEYKVETSRTLKPEYAGKA
KEAEKIGDAAYDITYETKLRGIPHSVLNARQHEQEAYIVADAGLPGVVTIATNMAGRGTD
IQLGGNLEMKMQKWLLEQRNMAVEVTPEMQAAKEAEFKAEIAVQKKIALEAGGLFVLGTE
RHESRRIDNQLRGRTGRQGDPGTSKFYLSCEDDLLRIFAGDRLDSIMKTFGVAEGEAITH
PWLNRAIETAQKRVETRNYDIRKNLLKYDDVVNDQRKAVFEQRQEFMDSEDLSELVGDFR
RDVVSDLVERYMPPKAYAEQWDIDGLDEKVRSTLGLELPLHDWAAEEGVSNEEIEERLLA
AADARAAERLEQIGADQTRGLEKQFMLQMIDMQWREHLVHLDHLRGVIGLRGYGQRDPLN
EYKTEAFSLFENLLYDLRHNVTRWLMTVEFRFQAPPELPEFQEIHLNPGTGENEMANPSA
QNPEGTLIGDDRSKLPVEALPPDWEMTGRNSPCPCGSGRKFKHCHGALV