Protein Info for A4249_RS12950 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 22 to 56 (35 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF00512: HisKA" amino acids 207 to 272 (66 residues), 67.1 bits, see alignment E=1.2e-22 PF02518: HATPase_c" amino acids 320 to 431 (112 residues), 103.2 bits, see alignment E=1.1e-33

Best Hits

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZF2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>A4249_RS12950 ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTNHTPGQDRSVLQHLIANGHMRYLIIASWAVALFTVTDWATAVLWFAAATASGLLRTFA
ERVLVLRDQGLHSRIKLMAATISCIAWSAAPLLAFIYGGAYGVPLGVALLMAGYVLVFTQ
MRAAPREALIVSAPYSVVVVLLFAKLWGTPGFWVVLSMIPVLALALLIKVAITQMKDSDL
EAVNRRQAELIAELETARDTANAASAAKSNFLGVISHELRTPMNGVLGAAQLLQMSELSD
RQKEFVGVIRDSGEGLMVLLNDILDITKIESGKMELDFVDVEAETLAARLTGPFKAQAEA
RGLTFTTDIRGPLPPLLRMDPLRLAQVTHNLLANAIKFTPQGEVRLIIDSEPAGEGRTTL
RLGVVDSGIGIAADDLTRLFQPFSQVDGSSTRKFGGTGLGLSICQRLAALMDGEITVTST
PGKGSTFTLHATFDTPQIEAVRVAA