Protein Info for A4249_RS12930 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: HAD-IA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00702: Hydrolase" amino acids 10 to 178 (169 residues), 85.6 bits, see alignment E=1.2e-27 PF13419: HAD_2" amino acids 14 to 184 (171 residues), 63.2 bits, see alignment E=7.1e-21 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 87 to 184 (98 residues), 58.8 bits, see alignment E=7.2e-20 PF13242: Hydrolase_like" amino acids 139 to 195 (57 residues), 27.5 bits, see alignment E=4.7e-10

Best Hits

KEGG orthology group: K01112, [EC: 3.1.3.-] (inferred from 62% identity to pba:PSEBR_a3436)

Predicted SEED Role

"Putative phosphatase YfbT" in subsystem 2-phosphoglycolate salvage

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NYQ7 at UniProt or InterPro

Protein Sequence (219 amino acids)

>A4249_RS12930 HAD-IA family hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MTALPASRAYQAFLFDMDGTLITSTPAAERVWTRWAARHGLDAAAFVPTIHGVRAIDTIR
RQNLPHIDLDAEVAWVERGEIEDVDGVAPIPGAIDFVRRLPPDRWAVVTSASIPLARARL
EAAGVTPPAVMVTAEDVERGKPDPAGYLKAAATLGFDIDDCLVFEDAEAGIKAGEAAGAD
VLVVTAAWTHPLETDHPTLADYADATLEVRSDGRLVLTL