Protein Info for A4249_RS12885 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Bax inhibitor-1/YccA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details PF01027: Bax1-I" amino acids 25 to 244 (220 residues), 170.8 bits, see alignment E=1.8e-54

Best Hits

Swiss-Prot: 66% identical to Y3663_CAUVC: Uncharacterized protein CC_3663 (CC_3663) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06890, (no description) (inferred from 85% identity to bsb:Bresu_0531)

Predicted SEED Role

"FIG005935: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZE4 at UniProt or InterPro

Protein Sequence (249 amino acids)

>A4249_RS12885 Bax inhibitor-1/YccA family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSDFNNGYARPLPQTADMSVDAGLRSFMLGVYNKLALGLVVAGALAYVTGNVPAVQQLLF
VQTADGRIGLTILGMIVQFSPLVMLFGSMFFMKNPTAKGVNMLYWAVVATIGAGLGILFL
RYTGGSLATTFLVTAAAFGGLSLVGYTTKKDLTGMGTFLIMGVIGLIIASILNMFLQSGT
FYLIISGLGVLIFSGLIAYDTQRLKMTYYALGGDQNAMGVATGFGALSLFINFVNLFQFL
LAFMGGNRN