Protein Info for A4249_RS12435 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF2975 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details PF11188: DUF2975" amino acids 82 to 201 (120 residues), 58.3 bits, see alignment E=4.1e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to bsb:Bresu_0426)

Predicted SEED Role

"FIG00481371: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZ80 at UniProt or InterPro

Protein Sequence (201 amino acids)

>A4249_RS12435 DUF2975 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRLPLPPNPLKRGEASVPNWLGAPIKALGPGSVSSVLKVVLDVAYILLWLITGVLLLLVI
AAIFIPLDNVNITVSGDFGGKQLPLTRTLLLFGLGAATAYFGGFMLILRSLRRIIRTLTM
GDPFQPDNVRRLRQIGLTLAVVTGGVWVAQGFVAKRLAPGVMDPQGFGELLTPIFSVLIV
FVLAEVFREGARLRRESELTI