Protein Info for A4249_RS12140 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details PF00672: HAMP" amino acids 79 to 131 (53 residues), 29 bits, see alignment 1.7e-10 PF00512: HisKA" amino acids 138 to 199 (62 residues), 34.8 bits, see alignment E=2.1e-12 PF02518: HATPase_c" amino acids 245 to 349 (105 residues), 70 bits, see alignment E=3.4e-23

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 49% identity to rpe:RPE_3323)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I103 at UniProt or InterPro

Protein Sequence (351 amino acids)

>A4249_RS12140 ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRAARVLGRRIAVRTALVILGVLGLSAAGAFALYGWVFENYPDAVASPQAWRPQSVDYVA
LASAAVVALIGATVAGLQLARRLVMPLTSLSGAARAIADGDLSARAMAGDRSFSETADLV
DDFNLMAARLETLAADMTTWNASIAHELRTPVTIVKGRLQAAADGVLPLDREMILTLLKP
VDALGRLIEDLRVVSLADSGRLQLRLTPQDLGKRLDDVRALVDVEAEAEGYPIGWTTPAT
VVVCDGDRIQQAVLALLDNVRRHADPGPVSVSLRADERFAVIAVEDSGPGLPDAMTRSVF
TAFKHGSGENGGTGLGLAAVRAIAEAHGGSARYLTGARLGSRIEICIPVVL