Protein Info for A4249_RS11565 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00753: Lactamase_B" amino acids 40 to 229 (190 residues), 72.6 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 59% identical to Y2304_BURP1: Probable metallo-hydrolase BURPS1710b_2304 (BURPS1710b_2304) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: None (inferred from 77% identity to mes:Meso_2535)

Predicted SEED Role

"FIG146518: Zn-dependent hydrolases, including glyoxylases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NNE1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>A4249_RS11565 MBL fold metallo-hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MSSPIPDPARDHAADIVRAALADPAQRPLVKSFFDEATFTVSHVVRDPGSDVCAIIDSVL
DYDPASGRTTHASADALIDYVKSEGLTVQWLLETHAHADHLSAAPYLQEKLGGQLAIGHE
ILTVQAVFGKIFNEGTDFRRDGSQFDHLFNDGDRFEIGGLKATVLHVPGHTPACLAYVIG
DAVFPGDTMFMPDYGTARCDFPGGDARTLYRSIHRLTSLPDEARVFLCHDYKAPPGRTEF
AWETTIGAQRTGNIHIRDDVSEDEFVAMRTQRDATLPMPKLILPSVQVNMNGGRPPEPED
NGVRYLKVPLNAL