Protein Info for A4249_RS11245 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: AsmA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 619 to 638 (20 residues), see Phobius details PF05170: AsmA" amino acids 30 to 151 (122 residues), 61.7 bits, see alignment E=3e-21 amino acids 171 to 552 (382 residues), 89.6 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: K07290, hypothetical protein (inferred from 71% identity to bsb:Bresu_0657)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1B0 at UniProt or InterPro

Protein Sequence (656 amino acids)

>A4249_RS11245 AsmA family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRTWRDWVRDNDPVYAAARRPGTAEKWAAGVVLVVVAAIVLFLALFDWNMLRGPIGRWAS
VKYDREIALTGDLDVNLFSWTPSAVVRGLKIGGPDWARDRDTADVDEVQASVRLRKLLAG
QVEMPLLSFTRPRVVLISTKDGRKSWQLNPNKPDNGEGLNLPVIQQLVIKDGQLTFEEQR
RGLTLEAAVNAREASSGQAGFVLDGRGDVRGAPMTVRIEGGPFINIRRDRPYRFEADVTG
ADSSLVAKGAITRPFDLGRFDATMTIQGRNMSDLYLLTGVALPNTPPYRLSGALNRDRRI
WTFKDFDGRVGASDLSGEVKVQSGQRLRVDADLTSRRLDIDDLAAVLGARTRTNAAGTDT
EAPVLVGGKLLPDAKLQTERLQTMDGTLSYRAGSVKANAFDVRQVNLGADLKDGILKLDP
ISFDFNRGALNGTARIDATKDTPYSTVDLRLAGYPLESIIPARNGSAPVTGRALGRAKLD
GPGASIHDFAAASKGSLSLVVPNGKMRAAFAELLGINASAGLLKLLSGDKSESQIRCAVA
DFNVSGGTATARTFVIDTDVVLAQGKGSINLGAETMNLRIEGESKKPRLLRLWAPITVSG
PLTAPKVGVDVGSVVSQGGLAGLLGAVVAPVTALFAFVDPGLAEDADCGRLIANAR