Protein Info for A4249_RS10460 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 794 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details PF00989: PAS" amino acids 273 to 375 (103 residues), 31.8 bits, see alignment E=4.5e-11 TIGR00229: PAS domain S-box protein" amino acids 396 to 508 (113 residues), 29.1 bits, see alignment E=4.5e-11 PF12860: PAS_7" amino acids 405 to 506 (102 residues), 43 bits, see alignment E=1.7e-14 PF00512: HisKA" amino acids 550 to 618 (69 residues), 74 bits, see alignment E=2.9e-24 PF02518: HATPase_c" amino acids 664 to 779 (116 residues), 95.6 bits, see alignment E=9.2e-31

Best Hits

Predicted SEED Role

"Two-component sensor histidine kinase PleC" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0C4 at UniProt or InterPro

Protein Sequence (794 amino acids)

>A4249_RS10460 ATP-binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRDEERRENRSGRRASDRAAGAPAWLRIAVLVLALIAAAYALMASREFSRPTREISRLEA
ENLKLNAELVASQTAVLIQSAEAGLAAGRTAIAAKRPPIEVVEAAQAAAPKVAFTLVGPG
ETVQAAKGEGPVVAGQANADGLRLEARIAPVLPKGGETRIVSAGGVVLASARAAEIGQPI
RTLIGVDPSALVDQAEPRTVTLGGQGGLAAAARTVAGGPYVVAISEGTTASFFDDAWVVL
APLLLGVGVVVLFVLYGLRQTRQHRERVATEKRFRIAVEAARCGVWEWDLAKGEVSLSDY
MAALLGFSRGGVTDAEDVIGRVHPRFQEDFRHALRQAAAYGAFEITFPVAGPDGRARWID
ARGQARGERGDMGFSAILGVALDITEARRAKAAAQAAESRLRDGVESISEAFVLFDRQGR
LILWNQAFEDAFGFDHGVVRRGAMKDELNRIAGLAIKAEHRPASGRAGLREVELNDGRWL
QLSERFTSEGGSVVTAADITAIKRQEAERRRAADDLRATVDQLESSQEKLSLLARKYEVA
MTRAEAANQAKSEFLANMSHELRTPLNAINGFSEIMASELFGPLNEKYKGYAGDILKSGQ
HLLSLINDVLDMAKIEAGKMTLHYEPVSLREVCEDAVRLMRGKVQDAGLKIAVEAGDLPD
IEADQRGVKQVMLNLISNAVKFTPEGGSIVVSLKPFVGAEGEDRVRVACADTGIGIAPED
LVRLARPFEQVEGQHSKTTQGTGLGLALTKSLIEMHGGQLSMESQPGVGTVVSFDLPVKR
PDQTVQPIRAAFAA