Protein Info for A4249_RS10025 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07991: IlvN
  • amino acids 16 to 179 (164 residues), 216.4 bits, E=3.7e-68
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 17 to 328 (312 residues), 425.4 bits, E=5.5e-132
• PF03807: F420_oxidored
  • amino acids 20 to 94 (75 residues), 27 bits, E=1.2e-09
• PF01450: IlvC
  • amino acids 185 to 328 (144 residues), 208.7 bits, E=9.4e-66

Best Hits

Swiss-Prot: 63% identical to ILVC_XANOM: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 81% identity to bsb:Bresu_3092)

MetaCyc: 54% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.86

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

See A0A160I094 at UniProt or InterPro

Protein Sequence (337 amino acids)

>A4249_RS10025 ketol-acid reductoisomerase (Brevundimonas sp. GW460-12-10-14-LB2)
MAITIYTNEDIKPGAIAGQRIAIIGYGSQGRAHAQNLKDSGHDVVAGVRHGGTGWKHATA
DGVPTAEPAEAVKGADIIAILTPDMVQGDVYRDIIEPNAKEGSALLFAHGFSIIYERITP
REDMDVILVAPKGPGDLVRREFQRGRGVPSLFAVEKDVTGKARDRAMGYAKGNGGATGGL
LETTFREETETDLFGEQAVLCGGAKELVIQGFNTLVEAGYQPEIAYFECLHELKLIVDLF
YEGGISKMHHFISETAKYGAVASGPRVVNEETKARMKTILDEIQDGTFARNWIAENEAGK
PQYEAWLKADRESHIEQVGARLRERMAWLNTPKAEAA