Protein Info for A4249_RS09315 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: class 1 fructose-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 3 to 183 (181 residues), 175.3 bits, E=1.1e-55
• PF18913: FBPase_C
  • amino acids 188 to 318 (131 residues), 157 bits, E=2.2e-50

Best Hits

Swiss-Prot: 65% identical to F16PA_CAUSK: Fructose-1,6-bisphosphatase class 1 (fbp) from Caulobacter sp. (strain K31)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 67% identity to cse:Cseg_1685)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See A0A160HZX0 at UniProt or InterPro

Protein Sequence (321 amino acids)

>A4249_RS09315 class 1 fructose-bisphosphatase (Brevundimonas sp. GW460-12-10-14-LB2)
MTRTRLDAHIAALDAPEGLKTVLTVVAATCADISKVVAGGALAGALGASGQINVQDEEQK
KLDVMTNDMLTEALLASSAVAGVASEEMDEVQPASNPAGEYLVLFDPLDGSSNIDINAPV
GTIVSVLKSATATPTEADFMQPGRRQVAALYAVYGPQTMLVLTTGAGVKGFTLSNDGDWI
LTHDEIAISPDTKEFAINMSNLRHWAEPVQTYVGDLLKGEEGLRAKNFNMRWVAAMVADV
HRILMRGGVFLYPWDRREPNKPGKLRLMYEGNPMAFLVEQAGGKATTDGRQAILDVQPEH
LHQRIPVALGSANEIDAYAGV