Protein Info for A4249_RS09255 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 421 (421 residues), 494.2 bits, see alignment E=1.5e-152 PF02844: GARS_N" amino acids 1 to 100 (100 residues), 126.8 bits, see alignment E=7.5e-41 PF01071: GARS_A" amino acids 101 to 292 (192 residues), 242.5 bits, see alignment E=5e-76 PF02843: GARS_C" amino acids 329 to 419 (91 residues), 101.2 bits, see alignment E=4.8e-33

Best Hits

Swiss-Prot: 65% identical to PUR2_PHEZH: Phosphoribosylamine--glycine ligase (purD) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 82% identity to bsb:Bresu_1848)

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZA4 at UniProt or InterPro

Protein Sequence (424 amino acids)

>A4249_RS09255 phosphoribosylamine--glycine ligase (Brevundimonas sp. GW460-12-10-14-LB2)
MNILLVGSGGREHALAWKIAQSPLVTRLVAAPGNPGIEKLCELRAVKADDADGLAALARE
IKADLVVVGPEVALAAGLADRLASAGIPCFGPTAKAAQLETSKAFSKGFLERHEIPTAGY
GVYDTVKDAKAALDVFRPPYVIKADGLAAGKGVAISPDRPDAEAEIERMLGGRFGAAGAR
VVIEEFMDGEEGSLFALCDGQRALLFGGAQDHKRAYDGDLGPNTGGMGAYSPAPVFTPEL
VQQADALIVQPTIRKMAEEGAPYRGVLYAGLMATEDGPKVVEFNARFGDPECQVLMMRMA
GDIVPYLLGCARGDVSGLASPAFKPQTVICVVMAAKGYPDSPLEGSIIRGADQDFGPHVQ
VFHAGTKRRDDGLLAASGGRVLNVCAEGDDIAQARERAYAAIRKIDWPGGFNRSDIGWRA
LDRG