Protein Info for A4249_RS08600 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 164 to 184 (21 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 150 to 368 (219 residues), 217.6 bits, see alignment E=1.2e-68 PF02405: MlaE" amino acids 154 to 364 (211 residues), 220 bits, see alignment E=1.4e-69

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 69% identity to bsb:Bresu_1453)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZM8 at UniProt or InterPro

Protein Sequence (371 amino acids)

>A4249_RS08600 ABC transporter permease (Brevundimonas sp. GW460-12-10-14-LB2)
MNTAAYEIVDRDGEARLRLTGDWTTTALGRLPTELSRDLEGRDIASIDTSDLGRFDTAGA
LALVQASSGRLSKSQWKDRPEAGRIYHMIELLERESAPAPKRPSAFVRTFAKIGRGVYDF
GGEGMLSLAFLGRLMAAVVEAAKHPGGIRWPAWVSQAERAGLDAIPIVMITNFFIGAVIA
FIGVDLLTDFGAQVFAVQLIGVAMFREFAVVIASVLLAGRSASAFAAEIGSMRMNQEVDA
MQVMGVNPFQALVIPRVASLVLMLPLLTFMGMIGGLVGGLVVCWSSLNLGPSFFFQRLVE
DGTMAQHLMVGLVKAPVFALVIAAIGCRQGMSVAGDVESLGRRVTAAVVQAIFAIIFLDA
VFALVFLELNI