Protein Info for A4249_RS07830 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 7 to 318 (312 residues), 114.7 bits, E=1.1e-36
• PF13450: NAD_binding_8
  • amino acids 9 to 36 (28 residues), 22.5 bits, see alignment (E = 1.7e-08)

Best Hits

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 51% identity to bsb:Bresu_1477)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• glyphosate degradation II (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

See A0A160HZB8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>A4249_RS07830 FAD-binding oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2)
MTSSSPIVIVGAGVLGLCTAFELHRRGRAVLVVDPGEVNASLVAAGMIAPAMESAIDDVS
PDYARLFRAGRDLWPDFAAAAGIALAHRPAEWRGGDLDRMEARLRALAFDARRESDRVAT
DEDYQVEPTQALAALRRALGDAVVAGTVTTITRIDGGWRLEVGDRWLHAEAVVLATGACD
AVAGLPDVARRLIEEIQPIRGQIGVAAEHLVDHVVRGPGAYVAPMASGAVIGATMEPGRR
DTTPDAEASERLTQAGWAALGRSPEPLSIEWRVGIRGATADGLPLAGAAPGEEGLFMALA
PRRNGWLLGPLVGAVVADAIEGRTASPHARALDPGRF