Protein Info for A4249_RS06835 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: prephenate dehydratase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF00800: PDT" amino acids 14 to 187 (174 residues), 155 bits, see alignment E=1e-49

Best Hits

KEGG orthology group: K04518, prephenate dehydratase [EC: 4.2.1.51] (inferred from 68% identity to bsb:Bresu_1572)

Predicted SEED Role

"Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HWY7 at UniProt or InterPro

Protein Sequence (191 amino acids)

>A4249_RS06835 prephenate dehydratase domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MQVAAPTEEKPGRVAYQGAPGSFSHEACLALRPWDEAVAFETFAQALDALRAGDCGCALI
PVENSTIGVVEPAATLVGALGVEPVAQVWRPIRHALMAIDGARLSDIRTVESHPIALAQC
KDTLAGLNVEVVEHFDTAGAARDVAEAGDPTRAAIAPVGAAEVYGLSILRNDLQDSGDNQ
TRFVLLSFPEG