Protein Info for A4249_RS06420 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NADH-quinone oxidoreductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00507: Oxidored_q4
  • amino acids 23 to 124 (102 residues), 129.5 bits, E=2.3e-42

Best Hits

Swiss-Prot: 70% identical to NUOA1_RHIME: NADH-quinone oxidoreductase subunit A 1 (nuoA1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 79% identity to bsb:Bresu_1934)

MetaCyc: 37% identical to ferredoxin-quinone oxidoreductase subunit C (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A160HYS3 at UniProt or InterPro

Protein Sequence (125 amino acids)

>A4249_RS06420 NADH-quinone oxidoreductase subunit A (Brevundimonas sp. GW460-12-10-14-LB2)
MNAFLLEYLPVLVFAGVAAFIGILFIVLPLLLAPKSPDSEKLSAYECGFNAFDDARMKFD
IRFYLVSILFIIFDLEVAFLFPWAVSMFDLSHAGMVFAFWSMMVFLGVLTIGFIYEWKKG
ALEWE