Protein Info for A4249_RS06410 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NADH-quinone oxidoreductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00329: Complex1_30kDa
  • amino acids 20 to 137 (118 residues), 166.9 bits, E=1.4e-53
• TIGR01961: NADH (or F420H2) dehydrogenase, subunit C
  • amino acids 20 to 136 (117 residues), 157.6 bits, E=9.9e-51

Best Hits

Swiss-Prot: 68% identical to NUOC_METS4: NADH-quinone oxidoreductase subunit C (nuoC) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 83% identity to bsb:Bresu_1936)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A160HY31 at UniProt or InterPro

Protein Sequence (189 amino acids)

>A4249_RS06410 NADH-quinone oxidoreductase subunit C (Brevundimonas sp. GW460-12-10-14-LB2)
MVGALGVEAQVAFGELTLVAPRERIVEVLTTLRDQFGFQQLLDLCGVDYPDRKERFEVVY
HLLSMTRNARLRVKVSTDETRPVPSVISAYPAANWFEREAYDMYGMLFSGHPDMRRLLTD
YGFEGHPLRKDFPMTGYVEVRYDEEQRRVVYEPVKLTQEFRTFDFLSPWEGAEYPAPVLP
GDEKAGGQA