Protein Info for A4249_RS06290 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01625: PMSR" amino acids 36 to 202 (167 residues), 185.6 bits, see alignment E=4.1e-59 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 37 to 184 (148 residues), 145.9 bits, see alignment E=6.3e-47

Best Hits

Swiss-Prot: 50% identical to MSRA2_CAUVC: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 61% identity to bsb:Bresu_3261)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZA6 at UniProt or InterPro

Protein Sequence (207 amino acids)

>A4249_RS06290 peptide-methionine (S)-S-oxide reductase MsrA (Brevundimonas sp. GW460-12-10-14-LB2)
MFLRTTALAAVASLTVAALAIGAPLARRAEAQTALQTAIFAGGCFWSEEKAFDDVPGVRS
AVSGFVGGHTANPSYEQVVRGGTGHMEAVQVTFDPRVVSYRTLVDRYWRTIDPTDPNGQF
CDQGPSYRSAVFATAAQRADAVASRDAAMRVLRKSFTTPVVGAQRFWPAGEEHQNYAKRH
AASYQAYRIGCRRPERLRAIWGDAAVS