Protein Info for A4249_RS06245 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 4 to 387 (384 residues), 436.3 bits, E=4.9e-135
• PF02670: DXP_reductoisom
  • amino acids 6 to 135 (130 residues), 119.7 bits, E=2.2e-38
• PF08436: DXP_redisom_C
  • amino acids 149 to 232 (84 residues), 129.8 bits, E=5.1e-42
• PF13288: DXPR_C
  • amino acids 264 to 385 (122 residues), 125.8 bits, E=1.6e-40

Best Hits

Swiss-Prot: 64% identical to DXR_CAUVN: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 77% identity to bsb:Bresu_2493)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

See A0A160HY00 at UniProt or InterPro

Protein Sequence (398 amino acids)

>A4249_RS06245 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Brevundimonas sp. GW460-12-10-14-LB2)
MIRRRITVLGATGSVGASTLDLMTQAEATGTGAFEVEALTGGSNIAKLAEQAKRWRPTLA
VTADPARLDELRDALSGTDVAVAAGDAAIVEAATRPADWIMASIVGAAGLKSAWAAAGTG
ATLALANKESLVCCGPALIERVKRAGGRLIPVDSEHSAIFQVFPAEAPERVAKLILTASG
GPFRNTPRDQMVAITPEQAVAHPNWSMGAKISVDSATMANKGLEMIEAAYLFDMPQDRID
VVVHPESIIHSLVEYVDGSTLAQMGPPDMRTPIACALAWPDRIAWPAPKLDLAALGRLTF
EAPDLTRFPALDLARQALKAGGATPAVFNAANEVAAFAFLDRKLAFLNIAAVVAETLERA
TKAGMAFGSGDACGAALSVDAETRRMAESVIAGLANAA