Protein Info for A4249_RS06110 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 PF02771: Acyl-CoA_dh_N" amino acids 42 to 156 (115 residues), 45.4 bits, see alignment E=2.8e-15 PF02770: Acyl-CoA_dh_M" amino acids 160 to 268 (109 residues), 40.8 bits, see alignment E=6.3e-14 PF00441: Acyl-CoA_dh_1" amino acids 280 to 445 (166 residues), 86.8 bits, see alignment E=5.2e-28 PF22924: ACOX_C_alpha1" amino acids 290 to 440 (151 residues), 30.3 bits, see alignment E=1e-10 PF08028: Acyl-CoA_dh_2" amino acids 298 to 438 (141 residues), 33.2 bits, see alignment E=1.8e-11 PF12806: Acyl-CoA_dh_C" amino acids 481 to 587 (107 residues), 79.6 bits, see alignment E=6.5e-26

Best Hits

Swiss-Prot: 51% identical to DMDC_RUEPO: 3-methylmercaptopropionyl-CoA dehydrogenase (dmdC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: None (inferred from 84% identity to bsb:Bresu_2569)

MetaCyc: 51% identical to 3-(methylsulfanyl)propanoyl-CoA dehydrogenase monomer (Ruegeria pomeroyi DSS-3)
RXN-12572 [EC: 1.3.99.41]

Predicted SEED Role

"3-methylmercaptopropionyl-CoA dehydrogenase (DmdC)"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HWN9 at UniProt or InterPro

Protein Sequence (594 amino acids)

>A4249_RS06110 acyl-CoA dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MTYRAPVRDLAFTLESVAGMADVAATGAFPDYDADVAGAVLEAAGQFSEEVLAPLNRIGD
QKGSTYANGAVTAAPGFADAYRQFAAGGWTGLSASTEAGGQALPKALELAAYETVHAANM
AFGLCPMLSLASIEALEQVGTEEQKAKYLTKLVSGEWTGAMVLTEPGAGSDLGSLITTAT
PNGDGTYALNGQKIYITWGDHDATDNIVHLVLARLPDAPKGPKGISLFLASKFAVKEDGT
LGDRNAFRPVGVEHKLGIHASPTCVMSYEGATAELVGQPNQGLAHMFVMMNAARLAVGVE
GVGIAERAYQHALAYALDRRQGRSVWTGEANAPIFDHPDVRRMLSVMKAKISAARAVCLS
TGVAADLARHAGTDEERRHWKGREDLFTPIAKAWSTDIGCEVASMGVQIHGGMGFIEETG
AAQYYRDARIAPIYEGTNGIQAMDLVGRKLSMDGGDSAKALIADMKVTLVDLGKLYSGKP
VERFATAIEAVEDATLWLLDQKADPNAAADVLAAADAYLKLLGDVAGGWMLAKGALAAKA
KLDANDGDPVWLQGKLDLYEVYAANVLGHVSSRLAAVGQGGDLLRRMTVDALAG