Protein Info for A4249_RS05995 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sodium-translocating pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 473 to 491 (19 residues), see Phobius details amino acids 519 to 538 (20 residues), see Phobius details amino acids 589 to 609 (21 residues), see Phobius details amino acids 615 to 637 (23 residues), see Phobius details amino acids 694 to 714 (21 residues), see Phobius details TIGR01104: V-type H(+)-translocating pyrophosphatase" amino acids 7 to 711 (705 residues), 857.8 bits, see alignment E=3.7e-262 PF03030: H_PPase" amino acids 13 to 705 (693 residues), 838.5 bits, see alignment E=2.2e-256

Best Hits

Swiss-Prot: 69% identical to HPPA_RHOPA: K(+)-insensitive pyrophosphate-energized proton pump (hppA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 91% identity to bsb:Bresu_1892)

Predicted SEED Role

"Pyrophosphate-energized proton pump (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.1

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYK8 at UniProt or InterPro

Protein Sequence (715 amino acids)

>A4249_RS05995 sodium-translocating pyrophosphatase (Brevundimonas sp. GW460-12-10-14-LB2)
MTNSLTLVFAAGVLAVLYGAAQTAVLMKASTGNDKMREIAAAIQEGASAYLKRQYLTIGI
VGIVILIAAYFLIGIYAAIGFLIGAVLSGAAGYAGMLISVRANVRTAQAASESLSKGLNL
AFRSGAITGMFVAGGALIGVSGYYIVLTQHLGLASTGREVIDGLVALGFGASLISIFARL
GGGIFTKGADVGGDMVGKVEAGIPEDDPRNAATIADNVGDNVGDCAGMAADLFETYAVTT
VATMVLAAIFFRGQPYVDLMMVLPLAICAVCIVTSIIGSFFVRLGKSNNIMGALYQGLIV
TGVLSIGAVWWVIDQMVTGPIVTASGLEIQPMALFWSGMVGLAVTAAIVVVTEYYTGSGF
RPVRSVANASVSGHGTNVIQGLAVSLEATALPALTIIVGIVASFQLAGLFGIAIATTTML
GVAGMIVALDAFGPVTDNAGGIAEMAGLPSDVRHSTDALDAVGNTTKAVTKGYAIGSAGL
GALVLFAAYTSDLQYFSANPADYPFFAGMGEIGFDLTNPYVVVGLLFGGLLPFLFGGMSM
MAVGRAAESVVAEVRRQFRENPGIMTYEVKPEYGRAVDILTKAAIREMIVPSLLPVLSPI
VLFVAVLGISDKANAFAALGAMLMGVIVTGLFVAISMTSGGGAWDNAKKVIEEGFTDKNG
VVHGKGSEAHKAAVTGDTVGDPYKDTSGPAVNPMIKITNIVALLLLAVLASGTIG