Protein Info for A4249_RS05895 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 210 to 227 (18 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 45 to 597 (553 residues), 515.1 bits, see alignment E=9.3e-159 PF01368: DHH" amino acids 99 to 255 (157 residues), 75 bits, see alignment E=1e-24 PF02272: DHHA1" amino acids 344 to 472 (129 residues), 61.8 bits, see alignment E=1.5e-20 PF17768: RecJ_OB" amino acids 488 to 596 (109 residues), 72.4 bits, see alignment E=4.5e-24

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 80% identity to bsb:Bresu_1912)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HWL0 at UniProt or InterPro

Protein Sequence (603 amino acids)

>A4249_RS05895 single-stranded-DNA-specific exonuclease RecJ (Brevundimonas sp. GW460-12-10-14-LB2)
MADDSGAKTLNAFLGVSRSLSGRAWRQRPADAATTRAHMQTLNLEEPLARALASRGVRAD
QGQDFLTPTLRALFPDPSSFIDMDAAADAILNALQAKANIHVFADYDVDGASSAALLVRW
FRAMGHTLSIYVPDRMTEGYGPSAKAFDTLKASGADLVITVDCGAAANEALAHAAAIALN
VVVIDHHLMRTEPPTALAVVNPNRPGCNSGQGNLAAAGVVFVLLAALNREGRRRSLFAER
PEPDIRQWLDLAALGAICDVTGLTGFNRALTGLGLKVMSDWRNPGLRALLAAAGAEPGPA
KSNHAGFILGPRINAGGRIGRSDLGARLLSTDDPTEAEALAIELDALNLSRRDVERAVTE
AVVRRVEATGAHADESAVVVVAGEDWHPGVVGIVAGRLRERWRKPVIVIGVDPVTGLGKG
SGRSQPGMNLGRAIQAAWESGILLAGGGHAMAAGLTMDGARVSELTAFLNERLATERVEA
VAQDVLEIDALIDPAAATRDLFESFERLAPFGPANPEPSFALSGVQAREPVAMNGGHVRC
RLIGPDGASVKAIAWRCADLPTGQALLSGQGGLSIVGRLKADDWNGRKGVQFEIEDVADP
RMI