Protein Info for A4249_RS05855 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF1295 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details PF06966: DUF1295" amino acids 4 to 240 (237 residues), 209.3 bits, see alignment E=6e-66 PF02544: Steroid_dh" amino acids 127 to 192 (66 residues), 29.3 bits, see alignment E=7.9e-11

Best Hits

KEGG orthology group: None (inferred from 52% identity to swi:Swit_4841)

Predicted SEED Role

"FIG005069: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYK9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>A4249_RS05855 DUF1295 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSTAWLVQKRTGQGGWADAFWSLGLGVAGVGVALFPIDGAAPSLRQYLAALLIGLWGLRL
GSHIAARAAHEEREDARYARLREDWGAGFQVKMFGFLMLQAGAAAFLALSVMAAARNPAP
GLTLQDAVATMVFVGALVGEAVSDRQLAAFKRNPANKGGICDVGLWAWSRHPNYFFEWVS
WCAWPVFAINLSGEWPWGWLALTGPAYMYWLLTQVSGVPLLEEHMRQSRPKAFEAYAART
SVFFPRPPRR