Protein Info for A4249_RS05770 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 193 to 228 (36 residues), 31.4 bits, see alignment 2e-11 PF16576: HlyD_D23" amino acids 229 to 334 (106 residues), 48 bits, see alignment E=1.5e-16 PF13437: HlyD_3" amino acids 234 to 322 (89 residues), 58.3 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: None (inferred from 67% identity to pzu:PHZ_c1445)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYI2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>A4249_RS05770 efflux RND transporter periplasmic adaptor subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MRQIRTPLIAYGAAVSAFALALASCGGGAEKAAPESEAEAAAAADYERGPHNGRLLRDGD
FALEVTIYEEGPEPLFRLYPYVNDKPVDPRQVQVTMALTRLGPKVDRFIFAPENDYLASP
GVVFEPHSFDVAVNAVRAGKRSNWTYQSYEGRTIISSQAAQAGGVTTERAGPAVLGETLP
LSGRVEITPEGQAEVFARYPGRIVSLNVQLGQRVSRGQVLARVESSESLQTYSVTAPISG
VITTKNANPGQITGNGPPMLTIGDPTRLHAEFFLYPRDAERVRVGQRVELKSLAGEHTAT
GVIEAILPSDDVLSQTLVAHVELPYQGGVWRPGLGVEGVVQVGAGEVPLAVKTKGLQPFR
DFTVVYAKVGDTYEVRMLELGRRTDEWTEVLGGIEPGTTYVVDGAFLIRADIDKSGASHD
H