Protein Info for A4249_RS05660 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Sec-independent protein translocase protein TatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details TIGR01410: twin arginine-targeting protein translocase TatB" amino acids 7 to 76 (70 residues), 79.2 bits, see alignment E=1.3e-26 PF02416: TatA_B_E" amino acids 7 to 52 (46 residues), 63.4 bits, see alignment E=5.9e-22

Best Hits

Swiss-Prot: 51% identical to TATB_PHEZH: Sec-independent protein translocase protein TatB (tatB) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 51% identity to pzu:PHZ_c1962)

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYG2 at UniProt or InterPro

Protein Sequence (192 amino acids)

>A4249_RS05660 Sec-independent protein translocase protein TatB (Brevundimonas sp. GW460-12-10-14-LB2)
MGGLGPGIGGFELVVIGLVALLVVGPKDLPVLMRRVGQMVAKARAMANEFRSSFDEMARQ
SELDDLRKEVEALRTGQGAVYPLGAEADAAFKDINAGLTGPTAAVALPAPETEAPVMTPA
ADEWPDTPAPVEPVTTTKSKRAAPKAKTGAAVAGSATAKPRSAAKPKTAAPAAKAKPAAA
KPKTSRKKAVDL