Protein Info for A4249_RS05070 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03284: thymidylate synthase
  • amino acids 24 to 106 (83 residues), 135.4 bits, E=1.1e-43
  • amino acids 107 to 285 (179 residues), 311.8 bits, E=2.1e-97
• PF00303: Thymidylat_synt
  • amino acids 24 to 285 (262 residues), 412.9 bits, E=2.3e-128

Best Hits

Swiss-Prot: 84% identical to TYSY_CAUVC: Thymidylate synthase (thyA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 84% identity to bsb:Bresu_2476)

MetaCyc: 64% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• folate transformations II (plants) (8/11 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• pyrimidine deoxyribonucleosides salvage (1/5 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

See A0A168NX91 at UniProt or InterPro

Protein Sequence (285 amino acids)

>A4249_RS05070 thymidylate synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MNAQVAIAELQARIAAAPADHPERQYLNLLRDILDNGVRRDDRTGTGTLGVFGRQMRFDL
SKGFPVLTTKKLHLRSIIVELLWFLRGETNIAYLKDNGVRIWDEWADAEGELGPVYGKQW
RSWTAPDGRVIDQIEKLVHGLKTNPNSRRHIVTAWNPADVDDMALPPCHCLFQFFVADGK
LSCQLYQRSADVFLGVPFNIASYALLTMMLAQVVGLEPGDFVHTFGDAHLYLNHLEQAEL
QLTREPLPLPVMQIAPKTDLFAFDLSDFTLEGYEAWPHIKAAVAV