Protein Info for A4249_RS04815 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details PF19312: NtrY_N" amino acids 41 to 312 (272 residues), 73.8 bits, see alignment E=3.9e-24 PF00672: HAMP" amino acids 332 to 382 (51 residues), 42.8 bits, see alignment 1.3e-14 PF00989: PAS" amino acids 402 to 464 (63 residues), 24.8 bits, see alignment E=4.7e-09 PF00512: HisKA" amino acids 509 to 577 (69 residues), 38.9 bits, see alignment E=1.8e-13 PF02518: HATPase_c" amino acids 621 to 737 (117 residues), 58.4 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 72% identity to bsb:Bresu_1782)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HW76 at UniProt or InterPro

Protein Sequence (756 amino acids)

>A4249_RS04815 PAS domain-containing sensor histidine kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDTPLARTASPDLASDDGSFWGWVDSERARTGFGLAFFLAVAITAAAIWLVAVAPGATS
GSARGSSSQIALIVLAANLLLISGLAIIVGRRVLTLVRSTDEAGSRLHLRFVALFSMVAL
VPSVLIALVFGVLVNRGVDQWFSQNVQASVENGAIVGRAYIQDVSAAMDADLVTISDQLG
SARSLFADRIQFNDALGQVGDIFGYPAIYILDGKGEVLARAEKTGAPPYLAPPRDELAAA
AEGGQPPQTVTQHPDAVRSIIALPAYGDAYLYLVRPLQDGLVARMNTSVQSIQAYREAQE
SRARIQSAFILSYLETALLVLVGAVWLGMSAASSISAPIGRLVKAAGQVAGGDFTARVDS
DGAPAEIATLSDAFNRMTGDLQAQQAALKAASDEAHDRSRFIETVLSGVSAGVIGLDKRG
RVSAINDSALQLLHIDDAEVLGHELAALSPELSDLVRRAEAHIEEDIDVSRGGETRRLRV
RIEGGLGGEMVLTFDDITRLVTAQRNAAWRDVARRIAHEIKNPLTPIQLSAERLKRKYRA
RIGEDVEIFDRCTDTIIRQVGDIGRMVDEFSSFARMPAPRFAPENPAEMLREAVFAQRVA
APDIVVDITEPLPKATMQADGRMVGQALINILKNAGESVAAHRLAAGEAAASDRAGVIAS
LTVEDGVATFVIEDDGVGLPARDRDRLTEPYVTTREKGTGLGLAIVKRICEDHGGELKLA
DAQTLRGARVCMIFPLKPHGEGGEGTERKLQTLAAE