Protein Info for A4249_RS04590 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR01979: cysteine desulfurase, SufS family" amino acids 14 to 411 (398 residues), 543.2 bits, see alignment E=1.8e-167 PF00266: Aminotran_5" amino acids 32 to 400 (369 residues), 469.7 bits, see alignment E=9.7e-145 PF00155: Aminotran_1_2" amino acids 73 to 249 (177 residues), 34.3 bits, see alignment E=2.4e-12 PF01041: DegT_DnrJ_EryC1" amino acids 73 to 211 (139 residues), 26.3 bits, see alignment E=6.4e-10

Best Hits

Swiss-Prot: 51% identical to CSD_STRCO: Probable cysteine desulfurase (csd) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 77% identity to bsb:Bresu_2177)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYM7 at UniProt or InterPro

Protein Sequence (412 amino acids)

>A4249_RS04590 cysteine desulfurase (Brevundimonas sp. GW460-12-10-14-LB2)
MADGAVVNTFDPYAVRAQFPILSRQVNGKPLVYLDNAASSQKPRAVIDALVETMEGGYAN
VHRGLHTLSNEATEAFEKAREIVARFLNAESAEQVVWTKGGTEAINLVANGLGLSIQPGD
EIIVSEMEHHSNIVPWHLLRERRGAVIKWIPVKDDGSLDMAAYAALLGPRTRMVAVTHMS
NVLGTINPVAEISRLAHAAGAQVLIDGCQGAVHATPDVQAIGCDFYVLTGHKLFAPTGIG
ALYGKAEALEALPPYQGGGEMIETVEQDRVTYARPPHRFEAGTPPILEAIGLGVGLEWLA
QYDRAAVQAHEHALYQHAVDRLQGQNWLRILGQAEGKGAILTFAVEGAHAHDVAQIMDRY
GVAVRAGLHCAEPLAKRMGVTSSTRASFALYNTVEDADAFVDALIKARNFFV