Protein Info for A4249_RS04440 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 352 to 375 (24 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 36 to 234 (199 residues), 48.8 bits, see alignment E=5.2e-17 PF07690: MFS_1" amino acids 46 to 376 (331 residues), 46.6 bits, see alignment E=2.4e-16

Best Hits

KEGG orthology group: None (inferred from 73% identity to sal:Sala_1509)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY04 at UniProt or InterPro

Protein Sequence (450 amino acids)

>A4249_RS04440 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MSASTTPSSESLERDAAALHTGHGKVDAGEIAIGVIIGRTSEFFDFFVYAIASVVVFPQL
IFPYAGAVGGTLLSFAVFALAFLARPLGTVLFIAIDRKFGRGAKLTTALLLLGTSTVSVA
FIPGYESIGMWAPVLLALTRIGQGVALGGTWDGLASLLALNAPEKKRGWYAMIPQLGAPI
GLLVASALFAFFLNTLSAPDFLDWGWRYPFFVAFAINVVALFARLRIVVTPAFQKLFETR
ELQPTPITQALRDEGPKIAIGAFAPLASFAMFHMVTVFPLSWVFLFTKETPVRFLLIEMV
GAVFGLLAILASGILADRYGRRTLLAITAAGIAAFSGFAPQLLNGGPVGELTFMISGFIL
LGLSFGQASGPVASSFSLTNRYTSSALTSDLAWLFGAGFAPLAALWISSQFGLIAAGAYL
LSGAICTLVALWLNRELARSSSDKDRAKTA