Protein Info for A4249_RS04355 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 472 to 489 (18 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 47 to 492 (446 residues), 347.9 bits, see alignment E=5.7e-108 PF13727: CoA_binding_3" amino acids 136 to 256 (121 residues), 57.5 bits, see alignment E=1.9e-19 PF02397: Bac_transf" amino acids 299 to 487 (189 residues), 206.6 bits, see alignment E=2.4e-65

Best Hits

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY05 at UniProt or InterPro

Protein Sequence (494 amino acids)

>A4249_RS04355 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MLDRPASLAADTPLKSRPSRGPFRPEIWLNARERSSVRLSAHYFRLIDVLMVCGLAFSAV
LAIQPTGLASITVGDAAPVVVGAVLVLELMRALQLYRFGRDTPWPLHMAGVVGVGVVSAG
VALVLGWLLDRPALDVIAPWALTTTAALALLHGLWLVVIARWRRLGVLSPNIVIVGATRN
ARRLIEQALERRDMNVLGVFDDRLARSPESVAGVPVLGDAKALLTHRLTPYVDRIVLAID
PEAGQRVRDLTQTLNALPNPLTVLVDSELGRDGLLNRLANAPLASLDGPADPDRRAFNKR
MQDLVIGAAALVVAAPIMSLVALAVKLDSRGPVFFRQRRHGFNHETIVVWKFRSMRHAAA
DATASRQVCADDDRVTRVGRFIRATSLDELPQIFNVLSGEMSLVGPRPHAIGMKTGETES
ALLVAEYAHRHRIKPGMTGWAAIKGSRGPVDTEAQVRERVQLDIEYIERQSFWLDLWVIA
VTIPVLLGDRAAVR