Protein Info for A4249_RS04055 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 119 to 145 (27 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 8 to 282 (275 residues), 42.2 bits, see alignment E=3.1e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NDZ6 at UniProt or InterPro

Protein Sequence (285 amino acids)

>A4249_RS04055 ABC transporter permease subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MLADAIRSETYRLSKNRTALFWSVLFIPIMGVILATLGFVVAKANEAKLAGKLPPDMMKG
GPLDLGMALVKSAGDFANPAILMFVLIGAATIYAGDYRWETWRLISARNTRPNLLTGKVA
VVGLVIVLATIATLISDVIASVIQAAVFGRPLTFSMNGEAAADFGLLTLTSWARILQFTM
LGLLAAVVTRSLLAALFAPLVIGVAQFFLPQLLLPMGVTPDGWLLPLLSPGMATDLLKAA
IEGGASAAQLPDHAVLKGVLSLAFWIGVPFAAAVAWFNRQDLSKE