Protein Info for A4249_RS03910 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 50S ribosomal protein L3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR03625: 50S ribosomal protein uL3" amino acids 4 to 205 (202 residues), 278.5 bits, see alignment E=1.8e-87 PF00297: Ribosomal_L3" amino acids 98 to 183 (86 residues), 43.3 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 76% identical to RL3_CAUVC: 50S ribosomal protein L3 (rplC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02906, large subunit ribosomal protein L3 (inferred from 82% identity to bsb:Bresu_1507)

MetaCyc: 50% identical to 50S ribosomal subunit protein L3 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L3p (L3e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXU4 at UniProt or InterPro

Protein Sequence (249 amino acids)

>A4249_RS03910 50S ribosomal protein L3 (Brevundimonas sp. GW460-12-10-14-LB2)
MRTGVIAKKLGMTRVFADDGAHVPVTVLQLDGCQVVGQRTQERDGYVALQLGAGTKKAKN
TNKAQRETFAKAEVEPKAYVTEFRVDADGLLDVGAELSAEHFLVGQKVDIQGETIGKGFA
GAMKRWNFGGLRATHGVSVSHRSHGSTGNRQDPGRTFPGKKMAGHYGTETVTTQNLTVVR
VDAERGLILIKGAVPGHDGSYVKVRDAIKKTRPADAPFPGALKSSKSAAQPASTPAEEAP
VEATEGGEA