Protein Info for A4249_RS03745 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR00416: DNA repair protein RadA" amino acids 1 to 448 (448 residues), 522.6 bits, see alignment E=4.2e-161 PF18073: Rubredoxin_2" amino acids 8 to 35 (28 residues), 36.1 bits, see alignment (E = 1.9e-12) PF08423: Rad51" amino acids 72 to 224 (153 residues), 24.8 bits, see alignment E=5.7e-09 PF06745: ATPase" amino acids 74 to 143 (70 residues), 46.3 bits, see alignment E=1.6e-15 PF13481: AAA_25" amino acids 85 to 223 (139 residues), 60.1 bits, see alignment E=1.1e-19 PF00004: AAA" amino acids 94 to 184 (91 residues), 25.4 bits, see alignment E=7.7e-09 PF13541: ChlI" amino acids 340 to 427 (88 residues), 33 bits, see alignment E=2.3e-11 PF05362: Lon_C" amino acids 352 to 428 (77 residues), 22.6 bits, see alignment E=3.3e-08

Best Hits

Swiss-Prot: 59% identical to RADA_BRUA2: DNA repair protein RadA (radA) from Brucella abortus (strain 2308)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 85% identity to bsb:Bresu_2356)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HWZ9 at UniProt or InterPro

Protein Sequence (456 amino acids)

>A4249_RS03745 DNA repair protein RadA (Brevundimonas sp. GW460-12-10-14-LB2)
MARDSALYVCQSCGSVHSKWSGQCGSCGQWNTLSEESRSAPPGAIKPSAAASARTRGIQF
ETLQSDTPEPPRITTGVAEFDRVCGGGVVPGSAILLSGDPGVGKSTLLLEVAAKAALRGS
RVAYISGEEAVEQIRARAKRMGLADAPVNLAAATALREILGTLKREQFDIVIVDSIQTLW
SDVHESGPGSITQVRACAGEMVRLAKSQGVAVVLVGHVTKDGQVAGPRVVEHLVDAVMTF
EGERGYPFRILRAGKNRFGATDEIGVFEMGDAGLREVANPSALFLGEGKERAPGAAVFAG
IEGSRPVLVEMQALVSKSAYGTPRRAVIGWETGRLAMVLAVLEARCGFGFGDQDVYLNVA
GGLRINEPAADLAAAAALISSATGVSLPQGCVVFGEIGLSGEVRSVGRAEARLREAQKLG
FDQVLSPTLTAKTKGVKVTSVTRLTDVVERISQNRY