Protein Info for A4249_RS03740 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: CvpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 28 to 48 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details PF02674: Colicin_V" amino acids 5 to 144 (140 residues), 77.6 bits, see alignment E=4.9e-26

Best Hits

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 70% identity to bsb:Bresu_2357)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXS0 at UniProt or InterPro

Protein Sequence (198 amino acids)

>A4249_RS03740 CvpA family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTGYDVFAIVVILFSVAAGWVRGGVREVITLLSATLAALVALIALPWTAGVTRAFVDPEW
AGSILAAVLTFFVVYFGLRLVGSMMSKSAKDHPHLGVIDRIFGLFIGGIRALVLIGAVHL
VIVAALPGERTPVWLGKAALYPVSAMGARMIQIVLPSIGRGADAITPVVDSSVRRGFSDE
EALPPTQSQPNSRREAAP