Protein Info for A4249_RS03710 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ribosome biogenesis GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF02421: FeoB_N" amino acids 4 to 157 (154 residues), 44.2 bits, see alignment E=7.6e-15 amino acids 179 to 343 (165 residues), 32 bits, see alignment E=4.1e-11 PF01926: MMR_HSR1" amino acids 4 to 120 (117 residues), 96.9 bits, see alignment E=4.1e-31 amino acids 179 to 297 (119 residues), 81.9 bits, see alignment E=1.9e-26 PF00071: Ras" amino acids 4 to 141 (138 residues), 22.5 bits, see alignment E=3.8e-08 TIGR00231: small GTP-binding protein domain" amino acids 4 to 158 (155 residues), 76.1 bits, see alignment E=4e-25 amino acids 176 to 342 (167 residues), 83.3 bits, see alignment E=2.5e-27 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 435 (432 residues), 536.8 bits, see alignment E=6.4e-165 PF00009: GTP_EFTU" amino acids 178 to 348 (171 residues), 31.6 bits, see alignment E=6.2e-11 PF14714: KH_dom-like" amino acids 355 to 435 (81 residues), 106.7 bits, see alignment E=2.9e-34

Best Hits

Swiss-Prot: 55% identical to DER_BRADU: GTPase Der (der) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03977, GTP-binding protein (inferred from 85% identity to bsb:Bresu_2535)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HVT7 at UniProt or InterPro

Protein Sequence (539 amino acids)

>A4249_RS03710 ribosome biogenesis GTPase Der (Brevundimonas sp. GW460-12-10-14-LB2)
MALKVAIVGRPNVGKSTLFNRLVGKRLALVDDRPGVTRDRRYADGNIGDMDLTLIDTAGY
EDVTDDSLEARMREQTEAALDDAELVMFMMDAREGVTSLDRIFAERLRRVHKPVILLANK
SESRESGGGVGEAHALGFGEPVAISAEHGEGMADLYAAIVAASQDIFVEEIDEPDKPIRI
AVIGRPNAGKSTLINRLIGDDRLLTGPEAGITRDSISVDWQFEGKNIRLVDTAGMRRKAR
VQEKLEKLSVADTIRAITFAEVVILMMDKDDAFDTQDLQLADLVEREGRALVYVASKWDL
EDEPQSRMAKLKGMAEDKLPQLKGSPFVALSSHSGRGVERLMPAVLQAYDTWSVKVKTKD
LNTWLSMATQRHPPPAVDGKRIKPKYIAQTKARPPTFVLMANRAESMPEHYKRYLVNSIR
ESFDLPGTPIRLNVKSSGVNPYAEGGAKSGPERYKGDAKTAPRRVKKAEKEEALSKLPGK
ALEQKKTRKAQPKILGGLKSSASKKAGSSVAVQKGARGGARQVSRSGRIRTGQKGGAKK