Protein Info for A4249_RS03635 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 120.1 bits, see alignment E=2.1e-38 PF17912: OB_MalK" amino acids 235 to 287 (53 residues), 37.5 bits, see alignment 7.3e-13 PF08402: TOBE_2" amino acids 281 to 352 (72 residues), 39.5 bits, see alignment E=1e-13

Best Hits

Swiss-Prot: 55% identical to MALK_VIBCH: Maltose/maltodextrin import ATP-binding protein MalK (malK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10230, sorbitol/mannitol transport system ATP-binding protein (inferred from 73% identity to bsb:Bresu_1467)

MetaCyc: 54% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXQ5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>A4249_RS03635 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Brevundimonas sp. GW460-12-10-14-LB2)
MANVRLVDVKKAFGAVEVLKGVDLEIADGEFVVFVGPSGCGKSTLLRTIAGLEEATTGQV
LIGDRVVNDLSPSDRGIAMVFQSYALYPHMTAYENMAFGLKLAKTDKGEIDRRVRAAAEA
LSITDYLDRKPKAMSGGQRQRVAIGRAIVREPEVFLFDEPLSNLDAALRVRMRYEFARLH
AELKTTMIYVTHDQVEAMTLADRIVVLNAGRIEQVGAPMDLYEHPANLFVAGFIGSPKMN
LLAAEIVEASAAGAKVKTSAGETIRVSVDAASAKPGDAVTLGVRPEYLTTTGDGDALTAE
VMFVETLGATTMAHLKHPASEDTLTVQLAGELRAKAGERLTLHVPAKQAHLFGADGKAFK
RL